Osteonectin (ON, Basement-membrane Protein 40, BM-40, Secreted Protein Acidic and Rich in Cysteine, SPARC) (HRP), Rabbit
Biozol Catalog Number:
USB-130758-HRP
Supplier Catalog Number:
130758-HRP
Alternative Catalog Number:
USB-130758-HRP-100
Manufacturer:
US Biological
Host:
Rabbit
Category:
Antikörper
Application:
WB
Immunogen:
Full length human SPARC, aa1-303 (NP_003109.1).
SPARC (secreted protein acidic and rich in cysteine)/Osteonectin is a matricellular glycoprotein that modulates cellular interactions with the ECM and is expressed in tissues undergoing remodeling. It functions as a de-adhesive protein, as a modulator of growth factor activity, and as a cell-cycle inhibitor. It induces changes in endothelial cell shape via F-actin, coincident with the appearance of intercellular gaps, that provide a paracellular pathway for extravasation of macromolecules. Tumor growth is enhanced in mice lacking SPARC due to changes in the ECM that create a more permissive environment for tumor progression. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MRAWIFFLLCLAGRALAAPQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.