OSMR (Oncostatin-M-specific Receptor Subunit beta, Interleukin-31 Receptor Subunit beta, IL-31 Receptor Subunit beta, IL-31R Subunit beta, IL-31R-beta, IL-31RB, OSMRB), Rabbit

Catalog Number: USB-130754
Article Name: OSMR (Oncostatin-M-specific Receptor Subunit beta, Interleukin-31 Receptor Subunit beta, IL-31 Receptor Subunit beta, IL-31R Subunit beta, IL-31R-beta, IL-31RB, OSMRB), Rabbit
Biozol Catalog Number: USB-130754
Supplier Catalog Number: 130754
Alternative Catalog Number: USB-130754-100
Manufacturer: US Biological
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: Full length human OSMR, aa1-342 (AAH10943.1)
Oncostatin M Receptor beta (OSM Rb) is a type I transmembrane protein that binds OSM with low affinity by itself and high affinity as an OSM Rb/gp130 heterodimer. OSM Rb is widely expressed and transduces signals involved in hematopoiesis, liver development, peripheral neuron repair and epithelial cell function. Mature human OSM Rb contains a 712aa extracellular domain (ECD) with one partial and one complete hematopoietin domain, an Ig-like domain and three fibronectin type-III domains, a 22aa transmembrane segment, and a 218aa cytoplasmic domain. Human OSM Rb ECD shares 55% aa sequence identity with mouse OSM Rb. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MALFAVFQTTFFLTLLSLRTYQSEVLAERLPLTPVSLKVSTNSTRQSLHLQWTVHNLPYHQELKMVFQIQISRIETSNVIWVGNYSTTVKWNQVLHWSWESELPLECATHFVRIKSLVDDAKFPEPNFWSNWSSWEEVSVQDSTGQDILFVFPKDKLVEEGTNVTICYVSRNIQNNVSCYLEGKQIHGEQLDPHVTAFNLNSVPFIRNKGTNIYCEASQGNVSEGMKGIVLFVSKVLEEPKDFSCETEDFKTLHCTWDPGTDTALGWSKQPSQSYTLFESFSGEKKLCTHKNWCNWQITQDSQETYNFTLIAENYLRKRSVNILFNLTHRGETRVVTAHRGH Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
NCBI: 010943
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2.