OSBPL8 (Oxysterol-binding Protein-related Protein 8, ORP-8, OSBP-related Protein 8, DKFZp686A11164, MGC126578, MGC133203, KIAA1451, ORP8, OSBP10) (HRP), Clone: [4H6], Mouse, Monoclonal
Biozol Catalog Number:
USB-130750-HRP
Supplier Catalog Number:
130750-HRP
Alternative Catalog Number:
USB-130750-HRP-100
Manufacturer:
US Biological
Host:
Mouse
Category:
Antikörper
Application:
ELISA, WB
Immunogen:
Partial recombinant corresponding to aa244-347 from human OSBPL8 (NP_065892) with GST tag. MW of the GST tag alone is 26kD.
ORP8 is a member of the oxysterol-binding protein related protein family. In humans, the gene family consists of 12 members, and extensive splice variation increases the number of encoded protein products substantially. The ORPs have been implicated as sterol sensors that regulate a number of cellular functions including sterol and neutral lipid metabolism, intracellular lipid transport, membrane trafficking and cell signaling. ORP8 has been recently shown to act as a sterol sensor that affects the reverse cholesterol transport process via modulation of ABCA1 expression and macrophage cholesterol efflux. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: IIRATSESDGRCWMDALELALKCSSLLKRTMIREGKEHDLSVSSDSTHVTFYGLLRANNLHSGDNFQLNDSEIERQHFKDQDMYSDKSDKENDQEHDESDNEV Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.