CYSTM1 (ORF1-FL49, Cysteine-rich and Transmembrane Domain-containing Protein 1, C5orf32) (FITC), Clone: [4E11], Mouse, Monoclonal

Catalog Number: USB-130746-FITC
Article Name: CYSTM1 (ORF1-FL49, Cysteine-rich and Transmembrane Domain-containing Protein 1, C5orf32) (FITC), Clone: [4E11], Mouse, Monoclonal
Biozol Catalog Number: USB-130746-FITC
Supplier Catalog Number: 130746-FITC
Alternative Catalog Number: USB-130746-FITC-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: FLISA, WB
Immunogen: Full length recombinant corresponding to aa1-98 from human ORF1-FL49 (AAH13643) with GST tag. MW of the GST tag alone is 26kD.
Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MNQENPPPYPGPGPTAPYPPYPPQPMGPGPMGGPYPPPQGYPYQGYPQYGWQGGPQEPPKTTVYVVEDQRRDELGPSTCLTACWTALCCCCLWDMLT Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
Clonality: Monoclonal
Clone Designation: [4E11]
NCBI: 013643
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).