CYSTM1 (ORF1-FL49, Cysteine-rich and Transmembrane Domain-containing Protein 1, C5orf32), Clone: [4E11], Mouse, Monoclonal

Catalog Number: USB-130746
Article Name: CYSTM1 (ORF1-FL49, Cysteine-rich and Transmembrane Domain-containing Protein 1, C5orf32), Clone: [4E11], Mouse, Monoclonal
Biozol Catalog Number: USB-130746
Supplier Catalog Number: 130746
Alternative Catalog Number: USB-130746-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: ELISA, WB
Immunogen: Full length recombinant corresponding to aa1-98 from human ORF1-FL49 (AAH13643) with GST tag. MW of the GST tag alone is 26kD.
Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MNQENPPPYPGPGPTAPYPPYPPQPMGPGPMGGPYPPPQGYPYQGYPQYGWQGGPQEPPKTTVYVVEDQRRDELGPSTCLTACWTALCCCCLWDMLT Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Clonality: Monoclonal
Clone Designation: [4E11]
NCBI: 013643
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2.