OLFM3 (Olfactomedin 3, Noelin-3, Olfactomedin-3, Optimedin, NOE3, UNQ1924/PRO4399) (PE), Clone: [3A2], Mouse, Monoclonal

Catalog Number: USB-130707-PE
Article Name: OLFM3 (Olfactomedin 3, Noelin-3, Olfactomedin-3, Optimedin, NOE3, UNQ1924/PRO4399) (PE), Clone: [3A2], Mouse, Monoclonal
Biozol Catalog Number: USB-130707-PE
Supplier Catalog Number: 130707-PE
Alternative Catalog Number: USB-130707-PE-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: FLISA, WB
Immunogen: Partial recombinant corresponding to aa108-207 from human OLFM3 (NP_477518) with GST tag. MW of the GST tag alone is 26kD.
Peripherally associated with AMPAR complex. AMPAR complex consists of an inner core made of 4 pore-forming GluA/GRIA proteins (GRIA1, GRIA2, GRIA3 and GRIA4) and 4 major auxiliary subunits arranged in a twofold symmetry. One of the two pairs of distinct binding sites is occupied either by CNIH2, CNIH3 or CACNG2, CACNG3. The other harbors CACNG2, CACNG3, CACNG4, CACNG8 or GSG1L. This inner core of AMPAR complex is complemented by outer core constituents binding directly to the GluA/GRIA proteins at sites distinct from the interaction sites of the inner core constituents. Outer core constituents include at least PRRT1, PRRT2, CKAMP44/SHISA9, FRRS1L and NRN1. The proteins of the inner and outer core serve as a platform for other, more peripherally associated AMPAR constituents, including OLFM3. Alone or in combination, these auxiliary subunits control the gating and pharmacology of the AMPAR complex and profoundly impact their biogenesis and protein processing. Homodimer. Interacts with MYOC. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: FRQIEDDRKTLMTKHFQELKEKMDELLPLIPVLEQYKTDAKLITQFKEEIRNLSAVLTGIQEEIGAYDYEELHQRVLSLETRLRDCMKKLTCGKLMKIT Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
Clonality: Monoclonal
Clone Designation: [3A2]
NCBI: 058170
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).