OIP5 (Protein Mis18-beta, Cancer/Testis Antigen 86, CT86, Opa-interacting Protein 5, OIP-5, MIS18B), Rabbit

Catalog Number: USB-130703
Article Name: OIP5 (Protein Mis18-beta, Cancer/Testis Antigen 86, CT86, Opa-interacting Protein 5, OIP-5, MIS18B), Rabbit
Biozol Catalog Number: USB-130703
Supplier Catalog Number: 130703
Alternative Catalog Number: USB-130703-100
Manufacturer: US Biological
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: Full length human OIP5, aa1-229 (NP_009211.1).
Required for recruitment of CENPA to centromeres and normal chromosome segregation during mitosis. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAAQPLRHRSRCATPPRGDFCGGTERAIDQASFTTSMEWDTQVVKGSSPLGPAGLGAEEPAAGPQLPSWLQPERCAVFQCAQCHAVLADSVHLAWDLSRSLGAVVFSRVTNNVVLEAPFLVGIEGSLKGSTYNLLFCGSCGIPVGFHLYSTHAALAALRGHFCLSSDKMVCYLLKTKAIVNASEMDIQNVPLSEKIAELKEKIVLTHNRLKSLMKILSEVTPDQSKPEN Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
NCBI: 007280
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2.