NXNL1 (TXNL6, Nucleoredoxin-like Protein 1, Thioredoxin-like Protein 6, RDCVF) (HRP), Rabbit

Catalog Number: USB-130669-HRP
Article Name: NXNL1 (TXNL6, Nucleoredoxin-like Protein 1, Thioredoxin-like Protein 6, RDCVF) (HRP), Rabbit
Biozol Catalog Number: USB-130669-HRP
Supplier Catalog Number: 130669-HRP
Alternative Catalog Number: USB-130669-HRP-100
Manufacturer: US Biological
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: Full length human NXNL1, aa1-212 (NP_612463.1).
NXNL1 may play a role in cone cell viability, slowing down cone degeneration, does not seem to play a role in degenerating rods (By similarity). Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MASLFSGRILIRNNSDQDELDTEAEVSRRLENRLVLLFFGAGACPQCQAFVPILKDFFVRLTDEFYVLRAAQLALVYVSQDSTEEQQDLFLKDMPKKWLFLPFEDDLRRDLGRQFSVERLPAVVVLKPDGDVLTRDGADEIQRLGTACFANWQEAAEVLDRNFQLPEDLEDQEPRSLTECLRRHKYRVEKAARGGRDPGGGGGEEGGAGGLF Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
NCBI: 138454
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).