ID3 (1R21, BHLHB25, HEIR1, DNA-binding Protein Inhibitor ID-3, Class B Basic Helix-loop-helix Protein 25, Helix-loop-helix Protein HEIR-1, ID-like Protein Inhibitor HLH 1R21, Inhibitor of DNA Binding 3) (APC), Clone: [4G1], Mouse,
ID3 (1R21, BHLHB25, HEIR1, DNA-binding Protein Inhibitor ID-3, Class B Basic Helix-loop-helix Protein 25, Helix-loop-helix Protein HEIR-1, ID-like Protein Inhibitor HLH 1R21, Inhibitor of DNA Binding 3) (APC), Clone: [4G1], Mouse,
ID3 (1R21, BHLHB25, HEIR1, DNA-binding Protein Inhibitor ID-3, Class B Basic Helix-loop-helix Protein 25, Helix-loop-helix Protein HEIR-1, ID-like Protein Inhibitor HLH 1R21, Inhibitor of DNA Binding 3) (APC), Clone: [4G1], Mouse,
Biozol Catalog Number:
USB-128205-APC
Supplier Catalog Number:
128205-APC
Alternative Catalog Number:
USB-128205-APC-100
Manufacturer:
US Biological
Host:
Mouse
Category:
Antikörper
Application:
FLISA, WB
Immunogen:
Partial recombinant corresponding to aa1-83 form human ID3 (NP_002158) with GST tag. MW of the GST tag alone is 26kD.
Members of the ID family of helix-loop-helix (HLH) proteins lack a basic DNA-binding domain and inhibit transcription through formation of nonfunctional dimers that are incapable of binding to DNA. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Sandwich FLISA: The detection limit is ~0.03ng/ml as a capture antibody Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEILQRVIDYILDLQVV Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
