ID2 (DNA-binding Protein Inhibitor ID-2, Class B Basic Helix-loop-helix Protein 26, bHLHb26, Inhibitor of DNA Binding 2, BHLHB26, MGC26389) (HRP), Rabbit
ID2 (DNA-binding Protein Inhibitor ID-2, Class B Basic Helix-loop-helix Protein 26, bHLHb26, Inhibitor of DNA Binding 2, BHLHB26, MGC26389) (HRP), Rabbit
ID2 (DNA-binding Protein Inhibitor ID-2, Class B Basic Helix-loop-helix Protein 26, bHLHb26, Inhibitor of DNA Binding 2, BHLHB26, MGC26389) (HRP), Rabbit
Biozol Catalog Number:
USB-128203-HRP
Supplier Catalog Number:
128203-HRP
Alternative Catalog Number:
USB-128203-HRP-100
Manufacturer:
US Biological
Host:
Rabbit
Category:
Antikörper
Application:
WB
Immunogen:
Full length human ID2, aa1-134 (AAH30639).
The protein encoded by this gene belongs to the inhibitor of DNA binding (ID) family, members of which are transcriptional regulators that contain a helix-loop-helix (HLH) domain but not a basic domain. Members of the ID family inhibit the functions of basic helix-loop-helix transcription factors in a dominant-negative manner by suppressing their heterodimerization partners through the HLH domains. This protein may play a role in negatively regulating cell differentiation. A pseudogene has been identified for this gene. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVSKMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALCG Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.