ID2 (DNA-binding Protein Inhibitor ID-2, Class B Basic Helix-loop-helix Protein 26, bHLHb26, Inhibitor of DNA Binding 2, BHLHB26, MGC26389) (APC), Rabbit

Catalog Number: USB-128203-APC
Article Name: ID2 (DNA-binding Protein Inhibitor ID-2, Class B Basic Helix-loop-helix Protein 26, bHLHb26, Inhibitor of DNA Binding 2, BHLHB26, MGC26389) (APC), Rabbit
Biozol Catalog Number: USB-128203-APC
Supplier Catalog Number: 128203-APC
Alternative Catalog Number: USB-128203-APC-100
Manufacturer: US Biological
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: Full length human ID2, aa1-134 (AAH30639).
The protein encoded by this gene belongs to the inhibitor of DNA binding (ID) family, members of which are transcriptional regulators that contain a helix-loop-helix (HLH) domain but not a basic domain. Members of the ID family inhibit the functions of basic helix-loop-helix transcription factors in a dominant-negative manner by suppressing their heterodimerization partners through the HLH domains. This protein may play a role in negatively regulating cell differentiation. A pseudogene has been identified for this gene. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVSKMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALCG Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
NCBI: 030639
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).