Partial recombinant corresponding to aa107-206 from human ICT1 (NP_001536) with GST tag. MW of the GST tag alone is 26kD.
The adult colon epithelium contains 3 differentiated cell types that arise from a multipotent stem cell. Deviation from the normal maturation pathway by neoplastic transformation is thought to initiate in stem cells or their early descendants. One potential marker is ICT1 whose mRNA and protein were more highly expressed in undifferentiated than in differentiated cells. [provided by RefSeq] Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Sandwich ELISA: The detection limit is ~0.03ng/ml as a capture antibody Optimal dilutions to be determined by the researcher. Amino Acid Sequence: TAEWIAEPVRQKIAITHKNKINRLGELILTSESSRYQFRNLADCLQKIRDMITEASQTPKEPTKEDVKLHRIRIENMNRERLRQKRIHSAVKTSRRVDMD Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
