ICOSL (B7-H2, CD275, ICOS Ligand, B7 Homolog 2, B7-like Protein Gl50, B7-related Protein 1, B7RP-1, ICOSLG, B7H2, B7RP1, KIAA0653), Clone: [2D12], Mouse, Monoclonal

Catalog Number: USB-128197
Article Name: ICOSL (B7-H2, CD275, ICOS Ligand, B7 Homolog 2, B7-like Protein Gl50, B7-related Protein 1, B7RP-1, ICOSLG, B7H2, B7RP1, KIAA0653), Clone: [2D12], Mouse, Monoclonal
Biozol Catalog Number: USB-128197
Supplier Catalog Number: 128197
Alternative Catalog Number: USB-128197-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: ELISA, WB
Immunogen: Partial recombinant protein corresponding to aa20-302 from ICOSLG (AAH64637) with GST tag. MW of the GST tag alone is 26kD.
B7-H2, or Inducible costimulator ligand (ICOSL), is a member of the Ig superfamily and belongs to the B7 family of costimulatory molecules. It specifically binds to ICOS, but not to other T cell costimulatory molecules such as CD28 and CTLA-4. B7-H2-ICOS interaction appears to be very important in the expansion of activated T cells and late-phase immune responses. B7-H2 enhances the proliferation of both CD4 and CD8 T cells, the secretion of Th1- and/or Th2-type cytokines, and the expression of CD154 (CD40 ligand) on T cells. It is expressed constitutively on B lymphocytes and at low levels on monocytes. Furthermore, B7-H2-ICOS interaction induces IL-10 production, which plays an important role in reducing immune responses. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: TQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSILAVLCLLVVVAVAIG Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Clonality: Monoclonal
Clone Designation: [2D12]
NCBI: 064637
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.4.