ICEBERG, an inhibitor of pro-caspase-1 activation, consists essentially of only a CARD. It inhibits generation of IL-1b by interacting with caspase-1 and preventing association with RIP2. The ICEBERG functions as a competitive antagonist of RIP2/pro-caspase-1 interactions and inhibits caspase-1-dependent pro-L-1b secretion in mononuclear cells. ICEBERG is induced by proinflammatory stimuli, suggesting that it may be part of a negative feedback loop. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MADQLLRKKRRIFIHSVGAGTINALLDCLLEDEVISQEDMNKVRDENDTVMDKARVLIDLVTGKGPKSCCKFIKHLCEEDPQLASKMGLH Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
