ICB1 (THEMIS2, C1orf38, ICB1, Protein THEMIS2, Induced by Contact to Basement Membrane 1 Protein, Thymocyte-expressed Molecule Involved in Selection Protein 2) (HRP), Clone: [1C3], Mouse, Monoclonal

Catalog Number: USB-128191-HRP
Article Name: ICB1 (THEMIS2, C1orf38, ICB1, Protein THEMIS2, Induced by Contact to Basement Membrane 1 Protein, Thymocyte-expressed Molecule Involved in Selection Protein 2) (HRP), Clone: [1C3], Mouse, Monoclonal
Biozol Catalog Number: USB-128191-HRP
Supplier Catalog Number: 128191-HRP
Alternative Catalog Number: USB-128191-HRP-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: ELISA
Immunogen: Full length recombinant corresponding to aa1-111 from C1orf38 (AAH31655) with GST tag. MW of the GST tag alone is 26kD.
Involved in cell adhesion. There are 4 isoforms produced by alternative splicing. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MEGQQVILHLPLSQKGPFWTWEPSAPRTLLQVLQDPALKDLVLTCPTLPWHSLILRPQYEIQAIMHIFSSLRIAATRSAAQTQGEDLARVHQGWLQYVQQDSCPQEGPQAR Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
Clonality: Monoclonal
Clone Designation: [1C3]
NCBI: 031655
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).