ICAM4 (Intercellular Adhesion Molecule 4, ICAM-4, Landsteiner-Wiener Blood Group Glycoprotein, LW Blood Group Protein, CD242, LW) (PE), Rabbit

Catalog Number: USB-128188-PE
Article Name: ICAM4 (Intercellular Adhesion Molecule 4, ICAM-4, Landsteiner-Wiener Blood Group Glycoprotein, LW Blood Group Protein, CD242, LW) (PE), Rabbit
Biozol Catalog Number: USB-128188-PE
Supplier Catalog Number: 128188-PE
Alternative Catalog Number: USB-128188-PE-100
Manufacturer: US Biological
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: Full length human ICAM4, aa1-272 (NP_001034221.1).
ICAM proteins are ligands for the leukocyte adhesion protein LFA-1 (integrin alpha-L/beta-2). ICAM4 is also a ligand for alpha-4/beta-1 and alpha-V integrins. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MGSLFPLSLLFFLAAAYPGVGSALGRRTKRAQSPKGSPLAPSGTSVPFWVRMSPEFVAVQPGKSVQLNCSNSCPQPQNSSLRTPLRQGKTLRGPGWVSYQLLDVRAWSSLAHCLVTCAGKTRWATSRITAYSVPGGLLGGDPEAWKPGHLFRKPGALHRPGSGQRDLDLRVCCWTPRLLAARDLPRAPQSRRPGGPQQLGTHYTDARLEPRAHSFGLRFHRCPCRDPPHCGRCVPMQVPSYEVPGVKGDVLCRLSEKKRNMKQSGEMAIHGG Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
NCBI: 001039132
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).