ICAM4 (Intercellular Adhesion Molecule 4, ICAM-4, Landsteiner-Wiener Blood Group Glycoprotein, LW Blood Group Protein, CD242, LW) (Biotin), Rabbit

Catalog Number: USB-128188-BIOTIN
Article Name: ICAM4 (Intercellular Adhesion Molecule 4, ICAM-4, Landsteiner-Wiener Blood Group Glycoprotein, LW Blood Group Protein, CD242, LW) (Biotin), Rabbit
Biozol Catalog Number: USB-128188-BIOTIN
Supplier Catalog Number: 128188-Biotin
Alternative Catalog Number: USB-128188-BIOTIN-100
Manufacturer: US Biological
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: Full length human ICAM4, aa1-272 (NP_001034221.1).
ICAM proteins are ligands for the leukocyte adhesion protein LFA-1 (integrin alpha-L/beta-2). ICAM4 is also a ligand for alpha-4/beta-1 and alpha-V integrins. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MGSLFPLSLLFFLAAAYPGVGSALGRRTKRAQSPKGSPLAPSGTSVPFWVRMSPEFVAVQPGKSVQLNCSNSCPQPQNSSLRTPLRQGKTLRGPGWVSYQLLDVRAWSSLAHCLVTCAGKTRWATSRITAYSVPGGLLGGDPEAWKPGHLFRKPGALHRPGSGQRDLDLRVCCWTPRLLAARDLPRAPQSRRPGGPQQLGTHYTDARLEPRAHSFGLRFHRCPCRDPPHCGRCVPMQVPSYEVPGVKGDVLCRLSEKKRNMKQSGEMAIHGG Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
NCBI: 001039132
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.