ICA1 (Islet Cell Autoantigen 1, 69kD Islet Cell Autoantigen, ICA69, Islet Cell Autoantigen p69, ICAp69, p69) (PE), Clone: [6G11], Mouse, Monoclonal

Catalog Number: USB-128184-PE
Article Name: ICA1 (Islet Cell Autoantigen 1, 69kD Islet Cell Autoantigen, ICA69, Islet Cell Autoantigen p69, ICAp69, p69) (PE), Clone: [6G11], Mouse, Monoclonal
Biozol Catalog Number: USB-128184-PE
Supplier Catalog Number: 128184-PE
Alternative Catalog Number: USB-128184-PE-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: FLISA, WB
Immunogen: Partial recombinant protein corresponding to aa1-110 from human ICA1 with GST tag. MW of the GST tag alone is 26kD.
Applications: Suitable for use in Western Blot and FLISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MSGHKCSYPWDLQDRYAQDKSVVNKMQQKYWETKQAFIKATGKKEDEHVVASDADLDAKLELFHSIQRTCLDLSKAIVLYQKRICFLSQEENELGKFLRSQGFQDKTRAG Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
Clonality: Monoclonal
Clone Designation: [6G11]
NCBI: 022307
Purity: Purified
Form: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).