Partial recombinant protein corresponding to aa1-110 from human ICA1 with GST tag. MW of the GST tag alone is 26kD.
Applications: Suitable for use in Western Blot and ELISA. Other applications not tested. Recommended Dilutions: Sandwich ELISA: The detection limit is ~0.3ng/ml as a capture antibody Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MSGHKCSYPWDLQDRYAQDKSVVNKMQQKYWETKQAFIKATGKKEDEHVVASDADLDAKLELFHSIQRTCLDLSKAIVLYQKRICFLSQEENELGKFLRSQGFQDKTRAG Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
