FAM3C (ILEI, Protein FAM3C, Interleukin-like EMT Inducer, GS3786, GS3876) (FITC), Clone: [3A3], Mouse, Monoclonal

Catalog Number: USB-126599-FITC
Article Name: FAM3C (ILEI, Protein FAM3C, Interleukin-like EMT Inducer, GS3786, GS3876) (FITC), Clone: [3A3], Mouse, Monoclonal
Biozol Catalog Number: USB-126599-FITC
Supplier Catalog Number: 126599-FITC
Alternative Catalog Number: USB-126599-FITC-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: FLISA, WB
Immunogen: Full-length recombinant protein corresponding to aa25-227 from FAM3C (AAH46932) with GST tag. MW of the GST tag alone is 26kD.
This gene is a member of the family with sequence similarity 3 (FAM3) family and encodes a secreted protein with a GG domain. A change in expression of this protein has been noted in pancreatic cancer-derived cells. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: QVFEIKMDASLGNLFARSALDTAARSTKPPRYKCGISKACPEKHFAFKMASGAANVVGPKICLEDNVLMSGVKNNVGRGINVALANGKTGEVLDTKYFDMWGGDVAPFIEFLKAIQDGTIVLMGTYDDGATKLNDEARRLIADLGSTSITNLGFRDNWVFCGGKGIKTKSPFEQHIKNNKDTNKYEGWPEVVEMEGCIPQKQD Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
Clonality: Monoclonal
Clone Designation: [3A3]
NCBI: 046932
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).