FAM3B (Protein FAM3B, Cytokine-like Protein 2-21, Pancreatic-derived Factor, PANDER, UNQ320/PRO365, PRED44, C21orf76, C21orf11, D21M16SJHU19e) (FITC), Clone: [1E7], Mouse, Monoclonal

Catalog Number: USB-126596-FITC
Article Name: FAM3B (Protein FAM3B, Cytokine-like Protein 2-21, Pancreatic-derived Factor, PANDER, UNQ320/PRO365, PRED44, C21orf76, C21orf11, D21M16SJHU19e) (FITC), Clone: [1E7], Mouse, Monoclonal
Biozol Catalog Number: USB-126596-FITC
Supplier Catalog Number: 126596-FITC
Alternative Catalog Number: USB-126596-FITC-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: FLISA, IHC, IP, WB
Immunogen: Full length recombinant corresponding to aa1-236 from human FAM3B (AAH57829) with GST tag. MW of the GST tag alone is 26kD.
Induces apoptosis of alpha and beta cells in a dose- and time-dependent manner. Applications: Suitable for use in FLISA, Western Blot, Immunoprecipitation and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MRPLAGGLLKVVFVVFASLCAWYSGYLLAELIPDAPLSSAAYSIRSIGERPVLKAPVPKRQKCDHWTPCPSDTYAYRLLSGGGRSKYAKICFEDNLLMGEQLGNVARGINIAIVNYVTGNVTATRCFDMYEGDNSGPMTKFIQSAAPKSLLFMVTYDDGSTRLNNDAKNAIEALGSKEIRNMKFRSSWVFIAAKGLELPSEIQREKINHSDAKNNRYSGWPAEIQIEGCIPKERS Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
Clonality: Monoclonal
Clone Designation: [1E7]
NCBI: 057829
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).