FAM206A (C9orf6, Protein FAM206A, FLJ20457), Mouse

Catalog Number: USB-126591
Article Name: FAM206A (C9orf6, Protein FAM206A, FLJ20457), Mouse
Biozol Catalog Number: USB-126591
Supplier Catalog Number: 126591
Alternative Catalog Number: USB-126591-50
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: IF, WB
Immunogen: Full length human C9orf6, aa1-182 (AAH15795).
The function of this protein remains unknown. Applications: Suitable for use in Immunofluorescence and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MATEPEAAEPVVPSLVDRYFTRWYKPDVKGKFCEDHCILQHSNRICVITLAESHPVLQSGKTIKSISYQISTNCSRLQNKVSGKFKRGAQFLTELAPLCKIYCSDGEEYTVSSCVRGRLMEVNENILHKPSILQEKPSTEGYIAVVLPKFEESKSITEGLLTQKQYEEVMVKRINATTATS* Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
NCBI: 015795
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2.