FAM189A2 (C9orf61, X123, Protein FAM189A2, Protein X123), Clone: [1H3], Mouse, Monoclonal

Catalog Number: USB-126590
Article Name: FAM189A2 (C9orf61, X123, Protein FAM189A2, Protein X123), Clone: [1H3], Mouse, Monoclonal
Biozol Catalog Number: USB-126590
Supplier Catalog Number: 126590
Alternative Catalog Number: USB-126590-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: ELISA, WB
Immunogen: Partial recombinant corresponding to aa383-451 from C9orf61 (NP_004807) with GST tag. MW of the GST tag alone is 26kD.
Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: QIMAPLQPSTSRAHRLPSRRQPGLLHLQSCGDLHTFTPAGRPRAERRPRRVEAERPHSLIGVIRETVL* Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Clonality: Monoclonal
Clone Designation: [1H3]
NCBI: 004816
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2.