FAM107A (DRR1, TU3A, Protein FAM107A, Down-regulated in Renal Cell Carcinoma 1, Protein TU3A, FLJ30158, FLJ45473), Mouse

Catalog Number: USB-126582
Article Name: FAM107A (DRR1, TU3A, Protein FAM107A, Down-regulated in Renal Cell Carcinoma 1, Protein TU3A, FLJ30158, FLJ45473), Mouse
Biozol Catalog Number: USB-126582
Supplier Catalog Number: 126582
Alternative Catalog Number: USB-126582-50
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: WB
Immunogen: Full length human FAM107A, aa1-144 (NP_009108.1).
When transfected into cell lines in which it is not expressed, suppresses cell growth. May play a role in tumor development. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Seqeuence: MYSEIQRERADIGGLMARPEYREWNPELIKPKKLLNPVKASRSHQELHRELLMNHRRGLGVDSKPELQRVLEHRRRNQLIKKKKEELEAKRLQCPFEQELLRRQQRLNQLEKPPEKEEDHAPEFIKVRENLRRIATLTSEEREL Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
NCBI: 007177
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2.