FAIM3 (Fas Apoptotic Inhibitory Molecule 3, Regulator of Fas-induced Apoptosis Toso, TOSO) (FITC), Clone: [1E4], Mouse, Monoclonal

Catalog Number: USB-126581-FITC
Article Name: FAIM3 (Fas Apoptotic Inhibitory Molecule 3, Regulator of Fas-induced Apoptosis Toso, TOSO) (FITC), Clone: [1E4], Mouse, Monoclonal
Biozol Catalog Number: USB-126581-FITC
Supplier Catalog Number: 126581-FITC
Alternative Catalog Number: USB-126581-FITC-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: FLISA, WB
Immunogen: Partial recombinant protein corresponding to aa124-223 from human FAIM3 (AAH06401, BC006401) with GST tag. MW of the GST tag alone is 26kD.
May play a role in the immune system processes. Protects cells from FAS-, TNF alpha- and FADD-induced apoptosis without increasing expression of the inhibitors of apoptosis BCL2 and BCLXL. Seems to activate an inhibitory pathway that prevents CASP8 activation following FAS stimulation, rather than blocking apoptotic signals downstream. May inhibit FAS-induced apoptosis by preventing CASP8 processing through CFLAR up-regulation. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SEYEPSWEEQPMPETPKWFHLPYLFQMPAYASSSKFVTRVTTPAQRGKVPPVHHSSPTTQITHRPRVSRASSVAGDKPRTFLPSTTASKISALEGLLKPQ Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
Clonality: Monoclonal
Clone Designation: [1E4]
NCBI: 06401
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).