FAIM2 (KIAA0950, LFG, LFG2, NMP35, TMBIM2, Protein Lifeguard 2, Fas Apoptotic Inhibitory Molecule 2, Neural Membrane Protein 35, Transmembrane BAX Inhibitor Motif-containing Protein 2) (HRP), Clone: [2C2], Mouse, Monoclonal100

Catalog Number: USB-126578-HRP
Article Name: FAIM2 (KIAA0950, LFG, LFG2, NMP35, TMBIM2, Protein Lifeguard 2, Fas Apoptotic Inhibitory Molecule 2, Neural Membrane Protein 35, Transmembrane BAX Inhibitor Motif-containing Protein 2) (HRP), Clone: [2C2], Mouse, Monoclonal100
Biozol Catalog Number: USB-126578-HRP
Supplier Catalog Number: 126578-HRP
Alternative Catalog Number: USB-126578-HRP-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: ELISA, WB
Immunogen: Full-length recombinant corresponding to aa1-317 from FAIM2 (AAH00051) with GST tag. MW of the GST tag alone is 26kD.
FAIM2 protects cells uniquely from Fas-induced apoptosis. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MTQGKLSVANKAPGTEGQQQVHGEKKEAPAVPSAPPSYEEATSGEGMKAGAFPPAPTAVPLHPSWAYVDPSSSSSYDNGFPTGDHELFTTFSWDDQKVRRVFVRKVYTILLIQLLVTLAVVALFTFCDPVKDYVQANPGWYWASYAVFFATYLTLACCSGPRRHFPWNLILLTVFTLSMAYLTGMLSSYYNTTSVLLCLGITALVCLSVTVFSFQTKFDFTSCQGVLFVLLMTLFFSGLILAILLPFQYVPWLHA Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
Clonality: Monoclonal
Clone Designation: [2C2]
NCBI: 000051
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).