Partial recombinant corresponding to aa551-651 from human FAF1 (NP_008982) with GST tag. MW of the GST tag alone is 26kD.
FAF1 (Fas-associated protein factor 1) specifically interacts with the cytoplasmic domain of wild type, but not mutated, Fas in both yeast and mammalian cells. When transiently expressed in T cells, FAF1 potentiates Fas-induced apoptosis. In contrast to TRADD, FADD, and RIP, FAF1 lacks a DDH (Death domain homologous region) and cannot induce apoptosis independent of Fas activation. Applications: Suitable for use in Immunofluorescence, FLISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 30ug/ml Optimal dilutions to be determined by the researcher. Amino Acid Sequence: EAIRLSLEQALPPEPKEENAEPVSKLRIRTPSGEFLERRFLASNKLQIVFDFVASKGFPWDEYKLLSTFPRRDVTQLDPNKSLLEVKLFPQETLFLEAKE Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.