FABP7 (Fatty Acid-binding Protein, Brain, Brain Lipid-binding Protein, BLBP, Brain-type Fatty Acid-binding Protein, B-FABP, Fatty Acid-binding Protein 7, Mammary-derived Growth Inhibitor Related, BLBP, FABPB, MRG), Mouse

Catalog Number: USB-126558
Article Name: FABP7 (Fatty Acid-binding Protein, Brain, Brain Lipid-binding Protein, BLBP, Brain-type Fatty Acid-binding Protein, B-FABP, Fatty Acid-binding Protein 7, Mammary-derived Growth Inhibitor Related, BLBP, FABPB, MRG), Mouse
Biozol Catalog Number: USB-126558
Supplier Catalog Number: 126558
Alternative Catalog Number: USB-126558-50
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: WB
Immunogen: Full length human FABP7, aa1-132 (AAH12299).
FABP7 (Fatty acid binding protein 7) is also known as brain fatty acid-binding protein (B-FABP) and is a member of fatty acid-binding proteins (FABPs) which are a family of small, highly conserved, cytoplasmic proteins to bind long-chain fatty acids and other hydrophobic ligands. FABP7 is expressed in radial glia by the activation of Notch receptors and binds DHA with the highest affinity among all of FABPs. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKA Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
NCBI: 012299
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2.