APBB2 (Amyloid beta A4 Precursor Protein-binding Family B Member 2, Protein Fe65-like 1, FE65L, FE65L1) (Biotin), Clone: [2D8], Mouse, Monoclonal

Catalog Number: USB-123388-BIOTIN
Article Name: APBB2 (Amyloid beta A4 Precursor Protein-binding Family B Member 2, Protein Fe65-like 1, FE65L, FE65L1) (Biotin), Clone: [2D8], Mouse, Monoclonal
Biozol Catalog Number: USB-123388-BIOTIN
Supplier Catalog Number: 123388-Biotin
Alternative Catalog Number: USB-123388-BIOTIN-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: ELISA, WB
Immunogen: Partial recombinant corresponding to aa1-100 from human APBB2 (AAH27946) with GST tag. MW of the GST tag alone is 26kD.
The protein encoded by this gene interacts with the cytoplasmic domains of amyloid beta (A4) precursor protein and amyloid beta (A4) precursor-like protein 2. This protein contains two phosphotyrosine binding (PTB) domains, which are thought to function in signal transduction. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MSEVLPADSGVDTLAVFMASSGTTDVTNRNSPATPPNTLNLRSSHNELLNAEIKHTETKNSTPPKCRKKYALTNIQAAMGLSDPAAQPLLGNGSANIKLV Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
Clonality: Monoclonal
Clone Designation: [2D8]
NCBI: 027946
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.