AP4M1 (MUARP2, AP-4 Complex Subunit mu-1, AP-4 Adapter Complex mu Subunit, Adapter-related Protein Complex 4 mu-1 Subunit, Mu Subunit of AP-4, Mu-adaptin-related Protein 2, Mu4-adaptin) (HRP), Clone: [2C4], Mouse, Monoclonal100

Catalog Number: USB-123386-HRP
Article Name: AP4M1 (MUARP2, AP-4 Complex Subunit mu-1, AP-4 Adapter Complex mu Subunit, Adapter-related Protein Complex 4 mu-1 Subunit, Mu Subunit of AP-4, Mu-adaptin-related Protein 2, Mu4-adaptin) (HRP), Clone: [2C4], Mouse, Monoclonal100
Biozol Catalog Number: USB-123386-HRP
Supplier Catalog Number: 123386-HRP
Alternative Catalog Number: USB-123386-HRP-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: ELISA, WB
Immunogen: Partial recombinant corresponding to aa354-454 from AP4M1 (NP_004713) with GST tag. MW of the GST tag alone is 26kD.
This gene encodes a subunit of the heterotetrameric AP-4 complex. The encoded protein belongs to the adaptor complexes medium subunits family. This AP-4 complex is involved in the recognition and sorting of cargo proteins with tyrosine-based motifs from the trans-golgi network to the endosomal-lysosomal system. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: AELAEGALRWDLPRVQGGSQLSGLFQMDVPGPPGPPSHGLSTSASPLGLGPASLSFELPRHTCSGLQVRFLRLAFRPCGNANPHKWVRHLSHSDAYVIRI Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
Clonality: Monoclonal
Clone Designation: [2C4]
NCBI: 004722
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).