AP4M1 (MUARP2, AP-4 Complex Subunit mu-1, AP-4 Adapter Complex mu Subunit, Adapter-related Protein Complex 4 mu-1 Subunit, Mu Subunit of AP-4, Mu-adaptin-related Protein 2, Mu4-adaptin) (Biotin), Clone: [2C4], Mouse, Monoclonal

Catalog Number: USB-123386-BIOTIN
Article Name: AP4M1 (MUARP2, AP-4 Complex Subunit mu-1, AP-4 Adapter Complex mu Subunit, Adapter-related Protein Complex 4 mu-1 Subunit, Mu Subunit of AP-4, Mu-adaptin-related Protein 2, Mu4-adaptin) (Biotin), Clone: [2C4], Mouse, Monoclonal
Biozol Catalog Number: USB-123386-BIOTIN
Supplier Catalog Number: 123386-Biotin
Alternative Catalog Number: USB-123386-BIOTIN-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: ELISA, WB
Immunogen: Partial recombinant corresponding to aa354-454 from AP4M1 (NP_004713) with GST tag. MW of the GST tag alone is 26kD.
This gene encodes a subunit of the heterotetrameric AP-4 complex. The encoded protein belongs to the adaptor complexes medium subunits family. This AP-4 complex is involved in the recognition and sorting of cargo proteins with tyrosine-based motifs from the trans-golgi network to the endosomal-lysosomal system. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: AELAEGALRWDLPRVQGGSQLSGLFQMDVPGPPGPPSHGLSTSASPLGLGPASLSFELPRHTCSGLQVRFLRLAFRPCGNANPHKWVRHLSHSDAYVIRI Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
Clonality: Monoclonal
Clone Designation: [2C4]
NCBI: 004722
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.