AP3B1 (AP-3 Complex Subunit beta-1, Adapter-related Protein Complex 3 Subunit beta-1, Adaptor Protein Complex AP-3 Subunit beta-1, Beta-3A-adaptin, Clathrin Assembly Protein Complex 3 beta-1 Large Chain, ADTB3A) (FITC), Clone: [3B
Biozol Catalog Number:
USB-123381-FITC
Supplier Catalog Number:
123381-FITC
Alternative Catalog Number:
USB-123381-FITC-100
Manufacturer:
US Biological
Host:
Mouse
Category:
Antikörper
Application:
FLISA, WB
Immunogen:
Partial recombinant corresponding to aa995-1095 from AP3B1 (NP_003655) with GST tag. MW of the GST tag alone is 26kD.
Subunit of non-clathrin- and clathrin-associated adaptor protein complex 3 that plays a role in protein sorting in the late-Golgi/trans-Golgi network (TGN) and/or endosomes. The AP complexes mediate both the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules. AP-3 appears to be involved in the sorting of a subset of transmembrane proteins targeted to lysosomes and lysosome-related organelles. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: KEQGVLTGMNETSAVIIAAPQNFTPSVIFQKVVNVANVGAVPSGQDNIHRFAAKTVHSGSLMLVTVELKEGSTAQLIINTEKTVIGSVLLRELKPVLSQG* Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.