AP1S1 (AP-1 Complex Subunit sigma-1A, Adapter-related Protein Complex 1 sigma-1A Subunit, Adaptor Protein Complex AP-1 sigma-1A Subunit, Clathrin Assembly Protein Complex 1 sigma-1A Small Chain, Clathrin Coat Assembly Protein AP19

Catalog Number: USB-123377
Article Name: AP1S1 (AP-1 Complex Subunit sigma-1A, Adapter-related Protein Complex 1 sigma-1A Subunit, Adaptor Protein Complex AP-1 sigma-1A Subunit, Clathrin Assembly Protein Complex 1 sigma-1A Small Chain, Clathrin Coat Assembly Protein AP19
Biozol Catalog Number: USB-123377
Supplier Catalog Number: 123377
Alternative Catalog Number: USB-123377-50
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: WB
Immunogen: Full length human AP1S1, aa1-158 (NP_001274.1).
Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the late-Golgi/trans-Golgi network (TGN) and/or endosomes. The AP complexes mediate both the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MMRFMLLFSRQGKLRLQKWYLATSDKERKKMVRELMQVVLARKPKMCSFLEWRDLKVVYKRYASLYFCCAIEGQDNELITLELIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLMGGDVQDTSKKSVLKAIEQADLLQEEDESPRSVLEEMGLA Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
NCBI: 001283
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2.