AP1M2 (AP-1 Complex Subunit mu-2, AP-mu Chain Family Member mu1B, Adaptor Protein Complex AP-1 mu-2 Subunit, Adaptor-related Protein Complex 1 mu-2 Subunit, Clathrin Assembly Protein Complex 1 Medium Chain 2, Golgi Adaptor HA1/AP1

Catalog Number: USB-123376
Article Name: AP1M2 (AP-1 Complex Subunit mu-2, AP-mu Chain Family Member mu1B, Adaptor Protein Complex AP-1 mu-2 Subunit, Adaptor-related Protein Complex 1 mu-2 Subunit, Clathrin Assembly Protein Complex 1 Medium Chain 2, Golgi Adaptor HA1/AP1
Biozol Catalog Number: USB-123376
Supplier Catalog Number: 123376
Alternative Catalog Number: USB-123376-50
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: WB
Immunogen: Full length human AP1M2, aa1-423 (NP_005489).
Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the trans-Golgi network (TGN) and endosomes. The AP complexes mediate the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MSASAVFILDVKGKPLISRNYKGDVAMSKIEHFMPLLVQREEEGALAPLLSHGQVHFLWIKHSNLYLVATTSKNANASLVYSFLYKTIEVFCEYFKELEEESIRDNFVIVYELLDELMDFGFPQTTDSKILQEYITQQSNKLETGKSRVPPTVTNAVSWRSEGIKYKKNEVFIDVIESVNLLVNANGSVLLSEIVGTIKLKVFLSGMPELRLGLNDRVLFELTGRSKNKSVELEDVKFHQCVRLSRFDNDRTISFIPPDGDFELMSYRLSTQVKPLIWIESVIEKFSHSRVEIMVKAKGQFKKQSVANGVEISVPVPSDADSPRFKTSVGSAKYVPERNVVIWSIKSFPGGKEYLMRAHFGLPSVEKEEVEGRPPIGVKFEIPYFTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLRTS Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
NCBI: 005498
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2.