ANXA4 (Annexin A4, Annexin-4, Annexin IV, Lipocortin IV, Endonexin I, Chromobindin-4, Protein II, P32.5, Placental Anticoagulant Protein II, PAP-II, PP4-X, 35-beta Calcimedin, Carbohydrate-binding Protein p33/p41, ANX4) (MaxLight
ANXA4 (Annexin A4, Annexin-4, Annexin IV, Lipocortin IV, Endonexin I, Chromobindin-4, Protein II, P32.5, Placental Anticoagulant Protein II, PAP-II, PP4-X, 35-beta Calcimedin, Carbohydrate-binding Protein p33/p41, ANX4) (MaxLight
ANXA4 (Annexin A4, Annexin-4, Annexin IV, Lipocortin IV, Endonexin I, Chromobindin-4, Protein II, P32.5, Placental Anticoagulant Protein II, PAP-II, PP4-X, 35-beta Calcimedin, Carbohydrate-binding Protein p33/p41, ANX4) (MaxLight
Biozol Catalog Number:
USB-123362-ML550
Supplier Catalog Number:
123362-ML550
Alternative Catalog Number:
USB-123362-ML550-100
Manufacturer:
US Biological
Host:
Rabbit
Category:
Antikörper
Application:
WB
Immunogen:
Full length human ANXA4, aa1-321 (NP_001144.1).
MaxLight(TM)550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor(TM)546, 555, DyLight(TM)549 , Cy3(TM), TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm), Emission (575nm), Extinction Coefficient 150,000. Annexin IV (ANX4) belongs to the annexin family of calcium-dependent phospholipid binding proteins. Although their functions are still not clearly defined, several members of the annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways. Isolated from human placenta, ANX4 is a protein that has possible interactions with ATP, and has in vitro anticoagulant activity and also inhibits phospholipase A2 activity. ANX4 is almost exclusively expressed in epithelial cells. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAMATKGGTVKAASGFNAMEDAQTLRKAMKGLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQVIVGMMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTPEEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVLVSLSAGGRDEGNYLDDALVRQDAQDLYEAGEKKWGTDEVKFLTVLCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLAIVKCMRNKSAYFAEKLYKSMKGLGTDDNTLIRVMVSRAEIDMLDIRAHFKRLYGKSLYSFIKGDTSGDYRKVLLVLCGGDD Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight(TM)550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.