ALOX12 (Arachidonate 12-lipoxygenase, 12S-type, 12S-LOX, 12S-lipoxygenase, Platelet-type Lipoxygenase 12, LOG12) (PE), Clone: [2D10], Mouse, Monoclonal

Catalog Number: USB-123245-PE
Article Name: ALOX12 (Arachidonate 12-lipoxygenase, 12S-type, 12S-LOX, 12S-lipoxygenase, Platelet-type Lipoxygenase 12, LOG12) (PE), Clone: [2D10], Mouse, Monoclonal
Biozol Catalog Number: USB-123245-PE
Supplier Catalog Number: 123245-PE
Alternative Catalog Number: USB-123245-PE-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: FLISA, WB
Immunogen: Partial recombinant corresponding to aa564-663 from human ALOX12 (NP_000688) with GST tag. MW of the GST tag alone is 26kD.
Oxygenase and 14,15-leukotriene A4 synthase activity. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: PPPTTKEDVTMATVMGSLPDVRQACLQMAISWHLSRRQPDMVPLGHHKEKYFSGPKPKAVLNQFRTDLEKLEKEITARNEQLDWPYEYLKPSCIENSVTI Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
Clonality: Monoclonal
Clone Designation: [2D10]
NCBI: 000697
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).