ALLC (Allantoate Amidinohydrolase, Probable Allantoicase) (PE), Clone: [3D3], Mouse, Monoclonal

Catalog Number: USB-123242-PE
Article Name: ALLC (Allantoate Amidinohydrolase, Probable Allantoicase) (PE), Clone: [3D3], Mouse, Monoclonal
Biozol Catalog Number: USB-123242-PE
Supplier Catalog Number: 123242-PE
Alternative Catalog Number: USB-123242-PE-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: FLISA, IP, WB
Immunogen: Partial recombinant corresponding to aa235-345 from human ALLC (NP_060906) with GST tag. MW of the GST tag alone is 26kD.
In enzymology, an allantoicase (EC 3.5.3.4) is an enzyme that catalyzes the chemical reaction allantoate + H2O (S)-ureidoglycolate + urea Thus, the two substrates of this enzyme are allantoate and H2O, whereas its two products are (S)-ureidoglycolate and urea. This enzyme belongs to the family of hydrolases, those acting on carbon-nitrogen bonds other than peptide bonds, specifically in linear amidines. The systematic name of this enzyme class is allantoate amidinohydrolase. This enzyme participates in purine metabolism by facilitating the utilization of purines as secondary nitrogen sources under nitrogen-limiting conditions. While purine degradation converges to uric acid in all vertebrates, its further degradation varies from species to species. Uric acid is excreted by birds, reptiles, and some mammals that do not have a functional uricase gene, whereas other mammals produce allantoin. Amphibians and microorganisms produce ammonia and carbon dioxide using the uricolytic pathway. Allantoicase performs the second step in this pathway catalyzing the conversion of allantoate into ureidoglycolate and urea. As of late 2007, two structures have been solved for this class of enzymes, with PDB accession codes 1O59 and 1SG3. The structure of allantoicase is best described as being composed of two repeats (the allantoicase repeats: AR1 and AR2), which are connected by a flexible linker. The crystal structure, resolved at 2.4A resolution, reveals that AR1 has a very similar fold to AR2, both repeats being jelly-roll motifs, composed of four-stranded and five-stranded antiparallel beta-sheets. Each jelly-roll motif has two conserved surface patches that probably constitute the active site. Applications: Suitable for use in FLISA, Western Blot and Immunoprecipitation. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GHPNNIIGVGGAKSMADGWETARRLDRPPILENDENGILLVPGCEWAVFRLAHPGVITRIEIDTKYFEGNAPDSCKVDGCILTTQEEAVIRQKWILPAHKWKPLLPVTKL Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
Clonality: Monoclonal
Clone Designation: [3D3]
NCBI: 018436
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).