ALG8 (Probable Dolichyl Pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase, Asparagine-linked Glycosylation Protein 8 Homolog, Dol-P-Glc:Glc(1)Man(9)GlcNAc(2)-PP-dolichyl alpha-1,3-glucosyltransferase, Dolichyl-P-Glc:Glc1

Catalog Number: USB-123236-BIOTIN
Article Name: ALG8 (Probable Dolichyl Pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase, Asparagine-linked Glycosylation Protein 8 Homolog, Dol-P-Glc:Glc(1)Man(9)GlcNAc(2)-PP-dolichyl alpha-1,3-glucosyltransferase, Dolichyl-P-Glc:Glc1
Biozol Catalog Number: USB-123236-BIOTIN
Supplier Catalog Number: 123236-Biotin
Alternative Catalog Number: USB-123236-BIOTIN-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: ELISA, WB
Immunogen: Partial recombinant corresponding to aa260-335 from human ALG8 (NP_076984) with GST tag. MW of the GST tag alone is 26kD.
This gene encodes a member of the ALG6/ALG8 glucosyltransferase family. The encoded protein catalyzes the addition of the second glucose residue to the lipid-linked oligosaccharide precursor for N-linked glycosylation of proteins. Mutations in this gene have been associated with congenital disorder of glycosylation type Ih (CDG-Ih). Alternatively spliced transcript variants encoding different isoforms have been identified. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: NQLPQVFSRLFPFKRGLCHAYWAPNFWALYNALDKVLSVIGLKLKFLDPNNIPKASMTSGLVQQFQHTVLPSVTP Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
Clonality: Monoclonal
Clone Designation: [2E10]
NCBI: 024079
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.