Myxovirus Resistance 1 Bovine Recombinant
Catalog Number:
RAY-228-21770-3
- Images (0)
| Article Name: | Myxovirus Resistance 1 Bovine Recombinant |
| Biozol Catalog Number: | RAY-228-21770-3 |
| Supplier Catalog Number: | 228-21770-3 |
| Alternative Catalog Number: | RAY-228-21770-3 |
| Manufacturer: | RayBiotech |
| Category: | Proteine/Peptide |
| Alternative Names: | Interferon-induced GTP-binding protein Mx1, Myxoma resistance protein 1, Myxovirus resistance protein 1, MX1, Interferon-Induced Protein P78, IFI-78K, IFI78, MxA. |
| NCBI: | 280872 |
| Expression System: | E. coli |
| Purity: | Greater than 90.0% as determined by: (a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
| Form: | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Sequence: | MGSSHHHHHHSSGLVPRGSHMVHSDLGIEELDSPESSLNGSEDMESKSNLYSQYEEKVRPCIDLIDSLRSLGVEQDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLVLRLKKLGNEDEWKGKVSFLDKEIEIPDASQVEKEISEAQIAIAGEGTGISHELISLEVSSPHVPDLTLIDLPGITRVAVGNQPPDIEYQIKSLIRKYILRQETINLVVVPANVDIATTEALRMAQEVDPQGDRTIGIL |
| Formula: | The MX1 protein was lyophilized from a (1mg/ml) 0.2 um filtered solution containing 20mM Tris-HCl, pH7.9, 500mM NaCl, 0.5mM Imidazole, 0.1mM DTT and 6M urea. |
Product Guarantee and Expert Support
