CD14, Human Recombinant HEK

Catalog Number: RAY-228-21750-3
Article Name: CD14, Human Recombinant HEK
Biozol Catalog Number: RAY-228-21750-3
Supplier Catalog Number: 228-21750-3
Alternative Catalog Number: RAY-228-21750-3
Manufacturer: RayBiotech
Category: Proteine/Peptide
Species Reactivity: Human
Alternative Names: Monocyte differentiation antigen CD14, Myeloid cell-specific leucine-rich glycoprotein, CD14.
NCBI: 929
Expression System: HEK293 cells
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence: TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMW
Formula: CD14 was lyophilized from a 0.2 uM filtered solution of 20mM PB and 150mM NaCl, PH 7.4.