CD14, Human Recombinant HEK
Catalog Number:
RAY-228-21750-3
- Images (0)
| Article Name: | CD14, Human Recombinant HEK |
| Biozol Catalog Number: | RAY-228-21750-3 |
| Supplier Catalog Number: | 228-21750-3 |
| Alternative Catalog Number: | RAY-228-21750-3 |
| Manufacturer: | RayBiotech |
| Category: | Proteine/Peptide |
| Species Reactivity: | Human |
| Alternative Names: | Monocyte differentiation antigen CD14, Myeloid cell-specific leucine-rich glycoprotein, CD14. |
| NCBI: | 929 |
| Expression System: | HEK293 cells |
| Purity: | Greater than 95% as determined by SDS-PAGE. |
| Form: | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Sequence: | TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMW |
| Formula: | CD14 was lyophilized from a 0.2 uM filtered solution of 20mM PB and 150mM NaCl, PH 7.4. |
Product Guarantee and Expert Support
