Dickkopf-Related Protein 3, Human Recombinant HEK
Catalog Number:
RAY-228-21746-2
- Images (0)
| Article Name: | Dickkopf-Related Protein 3, Human Recombinant HEK |
| Biozol Catalog Number: | RAY-228-21746-2 |
| Supplier Catalog Number: | 228-21746-2 |
| Alternative Catalog Number: | RAY-228-21746-2 |
| Manufacturer: | RayBiotech |
| Category: | Proteine/Peptide |
| Species Reactivity: | Human |
| Alternative Names: | Dickkopf 3 homolog (Xenopus laevis), dickkopf-related protein 3, regulated in glioma, RIG, RIG-like 7-1, RIG-like 5-6, Dkk-3, REIC. |
| NCBI: | 27122 |
| Expression System: | HEK293 cells |
| Purity: | Greater than 95% as determined by SDS-PAGE. |
| Form: | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Sequence: | APAPTATSAPVKPGPALSYPQEEATLNEMFREVEELMEDTQHKLRSAVEEMEAEEAAAKASSEVNLANLPPSYHNETNTDTKVGNNTIHVHREIHKITNNQTGQMVFSETVITSVGDEEGRRSHECIIDEDCGPSMYCQFASFQYTCQPCRGQRMLCTRDSECCGDQLCVWGHCTKMATRGSNGTICDNQRDCQPGLCCAFQRGLLFPVCTPLPVEGELCHDPASRLLDLITWELEPDGALDRCPCASGLLCQPH |
| Formula: | DKK3 was lyophilized from a 0.2 uM filtered solution of 20mM PB and 150mM NaCl, pH 7.2. |
Product Guarantee and Expert Support
