Streptavidin Recombinant
Catalog Number:
RAY-228-13234-2
- Images (0)
| Article Name: | Streptavidin Recombinant |
| Biozol Catalog Number: | RAY-228-13234-2 |
| Supplier Catalog Number: | 228-13234-2 |
| Alternative Catalog Number: | RAY-228-13234-2 |
| Manufacturer: | RayBiotech |
| Category: | Proteine/Peptide |
| Expression System: | E. coli |
| Purity: | Greater than 98.0% as determined by SDS-PAGE and HPLC. |
| Form: | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Sequence: | MAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAAS. |
| Formula: | Lyophilized in 10mM potassium phosphate buffer pH 6.5. |
Product Guarantee and Expert Support
