Polyclonal Rabbit anti-Human CXCL11 Antibody (IHC, WB) LS-C334557

Catalog Number: LS-C334557-100
Article Name: Polyclonal Rabbit anti-Human CXCL11 Antibody (IHC, WB) LS-C334557
Biozol Catalog Number: LS-C334557-100
Supplier Catalog Number: LS-C334557-100
Alternative Catalog Number: LS-C334557-100
Manufacturer: LifeSpan Biosciences
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 22-94 of human CXCL11 (NP_005400.1). FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF
Conjugation: Unconjugated
Alternative Names: CXCL11, Beta-R1, Chemokine h174, Chemokine ip-9, Chemokine itac, H174, I-TAC, IP9, ITAC, IP-9, SCYB11, Small inducible cytokine B11, B-R1, C-X-C motif chemokine 11, SCYB9B, Small-inducible cytokine B11
CXCL11 antibody LS-C334557 is an unconjugated rabbit polyclonal antibody to human CXCL11. Validated for IHC and WB.
Clonality: Polyclonal
NCBI: 6373
Buffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Purity: Affinity purified
Form: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Dilute: IHC (1:100 - 1:200), WB (1:500 - 1:2000)
Application Notes: The predicted MW is 10kDa, while the observed MW by Western blot was Refer to Figures.
Western blot analysis of extracts of various cell lines.
Immunohistochemistry of paraffin-embedded human prostate.