Polyclonal Rabbit anti-Human CRABP2 Antibody (IHC, IF, WB) LS-C334512

Catalog Number: LS-C334512-20
Article Name: Polyclonal Rabbit anti-Human CRABP2 Antibody (IHC, IF, WB) LS-C334512
Biozol Catalog Number: LS-C334512-20
Supplier Catalog Number: LS-C334512-20
Alternative Catalog Number: LS-C334512-20
Manufacturer: LifeSpan Biosciences
Host: Rabbit
Category: Antikörper
Application: IF, IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 22-94 of human CRABP2 (NP_001869.1). VLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKM
Conjugation: Unconjugated
Alternative Names: CRABP2, CRABP-II, RBP6
CRABP2 antibody LS-C334512 is an unconjugated rabbit polyclonal antibody to CRABP2 from human. It is reactive with human, mouse and rat. Validated for IF, IHC and WB.
Clonality: Polyclonal
NCBI: 1382
Buffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Purity: Affinity purified
Form: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Dilute: IF (1:20 - 1:100), IHC (1:50 - 1:200), WB (1:500 - 1:2000)
Application Notes: The predicted MW is 15kDa, while the observed MW by Western blot was 15kDa.
Western blot analysis of extracts of various cell lines.
Immunohistochemistry of paraffin-embedded rat brain tissue.