Polyclonal Rabbit anti-Human H1F0 Antibody (IHC, WB) LS-C332470

Catalog Number: LS-C332470-20
Article Name: Polyclonal Rabbit anti-Human H1F0 Antibody (IHC, WB) LS-C332470
Biozol Catalog Number: LS-C332470-20
Supplier Catalog Number: LS-C332470-20
Alternative Catalog Number: LS-C332470-20
Manufacturer: LifeSpan Biosciences
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-105 of human H1F0 (NP_005309.1). MTENSTSAPAAKPKRAKASKKSTDHPKYSDMIVAAIQAEKNRAGSSRQSIQKYIKSHYKVGENADSQIKLSIKRLVTTGVLKQTKGVGASGSFRLAKSDEPKKSV
Conjugation: Unconjugated
Alternative Names: H1F0, H1 histone family, member 0, Histone H1(0), H1.0, H1(0), H1-0, H10, H1FV, Histone H1, Histone H1.0
H1F0 antibody LS-C332470 is an unconjugated rabbit polyclonal antibody to H1F0 from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
Clonality: Polyclonal
NCBI: 3005
Buffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Purity: Affinity purified
Form: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Dilute: IHC (1:50 - 1:200), WB (1:500 - 1:2000)
Application Notes: The predicted MW is 19kDa/20kDa, while the observed MW by Western blot was 30kDa.
Western blot analysis of extracts of various cell lines.
Immunohistochemistry of paraffin-embedded mouse brain tissue.
516,00 €
20 µl
* VAT and and shipping costs not included.
Errors and price changes excepted
Availability
ORDER BY EMAIL
Product Guarantee and Expert Support
BIOZOL