Polyclonal Rabbit anti-Human PTPN11 / SHP-2 / NS1 Antibody (IHC, WB) LS-C332257

Catalog Number: LS-C332257-100
Article Name: Polyclonal Rabbit anti-Human PTPN11 / SHP-2 / NS1 Antibody (IHC, WB) LS-C332257
Biozol Catalog Number: LS-C332257-100
Supplier Catalog Number: LS-C332257-100
Alternative Catalog Number: LS-C332257-100
Manufacturer: LifeSpan Biosciences
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 514-593 of human PTPN11 (NP_002825.3). IYMAVQHYIETLQRRIEEEQKSKRKGHEYTNIKYSLADQTSGDQSPLPPCTPTPPCAEMREDSARVYENVGLMQQQKSFR
Conjugation: Unconjugated
Alternative Names: PTPN11, Bptp-3, BPTP3, CFC, Csw, Corkscrew csw, Gene corkscrew, Phosphatase corkscrew, PTP-2C, SHP2, PTP-1D, PTP2C, SHP-2, SHPTP2, Noonan syndrome 1, SH-PTP2, SH-PTP3
NS1 antibody LS-C332257 is an unconjugated rabbit polyclonal antibody to NS1 (PTPN11 / SHP-2) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
Clonality: Polyclonal
NCBI: 5781
Buffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Purity: Affinity purified
Form: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Dilute: IHC (1:50 - 1:100), WB (1:500 - 1:1000)
Application Notes: The predicted MW is 52kDa/68kDa, while the observed MW by Western blot was 71kDa.
Western blot analysis of extracts of various cell lines.
Immunohistochemistry of paraffin-embedded rat spleen tissue.