Polyclonal Rabbit anti-Human IGF2BP2 Antibody (IHC, WB) LS-C332239

Catalog Number: LS-C332239-100

Images (2)
See all images and image information

Article Name:	Polyclonal Rabbit anti-Human IGF2BP2 Antibody (IHC, WB) LS-C332239
Biozol Catalog Number:	LS-C332239-100
Supplier Catalog Number:	LS-C332239-100
Alternative Catalog Number:	LS-C332239-100
Manufacturer:	LifeSpan Biosciences
Host:	Rabbit
Category:	Antikörper
Application:	IHC, WB
Species Reactivity:	Human, Mouse
Immunogen:	A synthetic peptide corresponding to a sequence within amino acids 500 to the C-Terminus of human IGF2BP2 (NP_006539.3). NFFNPKEEVKLEAHIRVPSSTAGRVIGKGGKTVNELQNLTSAEVIVPRDQTPDENEEVIVRIIGHFFASQTAQRKIREIVQQVKQQEQKYPQGVASQRSK
Conjugation:	Unconjugated
Alternative Names:	IGF2BP2, IMP2, IGF2 mRNA-binding protein 2, p62, VICKZ2, IGF-II mRNA-binding protein 2, IMP-2, VICKZ family member 2

IGF2BP2 antibody LS-C332239 is an unconjugated rabbit polyclonal antibody to IGF2BP2 from human. It is reactive with human and mouse. Validated for IHC and WB.

Clonality:	Polyclonal
NCBI:	10644
Buffer:	PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Purity:	Affinity purified
Form:	PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Application Dilute:	IHC (1:50 - 1:100), WB (1:200 - 1:2000)
Application Notes:	The predicted MW is 54kDa/58kDa/59kDa/61kDa/66kDa, while the observed MW by Western blot was 66kDa.

	Western blot analysis of extracts of Jurkat cells.
	Immunohistochemistry of paraffin-embedded mouse liver tissue.

* VAT and and shipping costs not included.
Errors and price changes excepted