Human TNFSF18 protein
Catalog Number:
BYT-ORB705125
- Images (5)
| Article Name: | Human TNFSF18 protein |
| Biozol Catalog Number: | BYT-ORB705125 |
| Supplier Catalog Number: | orb705125 |
| Alternative Catalog Number: | BYT-ORB705125-20,BYT-ORB705125-100,BYT-ORB705125-1 |
| Manufacturer: | Biorbyt |
| Category: | Proteine/Peptide |
| This Human TNFSF18 protein spans the amino acid sequence from region 72-199aa. Purity: Greater than 94% as determined by SDS-PAGE. |
| Molecular Weight: | 42.8 kDa |
| UniProt: | Q9UNG2 |
| Buffer: | Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4 |
| Source: | Homo sapiens (Human) |
| Purity: | Greater than 94% as determined by SDS-PAGE. |
| Form: | Lyophilized powder |
| Sequence: | QLETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFIS |
| Application Notes: | Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized TNFRSF18 at 2 µg/ml can bind TNFSF18 , the EC50 is 2.565 to 2.940 ng/ml.Human TNFRSF18 protein hFc tag captured on COOH chip can bind Human TNFSF18 protein hFc and Flag tag with an affinity constant of 38.5 nM as detected by LSPR Assay. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference |
|
|
orb705125 |
|
|
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. |
|
|
orb705125 |
|
|
Measured by its binding ability in a functional ELISA. Immobilized TNFRSF18 at 2 µg/ml can bind TNFSF18, the EC50 is 2.565 to 2.940 ng/ml. |
|
|
Human TNFRSF18 protein hFc tag captured on COOH chip can bind Human TNFSF18 protein hFc and Flag tag with an affinity constant of 38.5 nM as detected by LSPR Assay. |
Product Guarantee and Expert Support
