Human IL3 protein

Catalog Number: BYT-ORB594806
Article Name: Human IL3 protein
Biozol Catalog Number: BYT-ORB594806
Supplier Catalog Number: orb594806
Alternative Catalog Number: BYT-ORB594806-10,BYT-ORB594806-50,BYT-ORB594806-500,BYT-ORB594806-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Interleukin-3, IL-3, Hematopoietic Growth Factor, Mast Cell Growth Factor, MCGF, Multipotential Colony-Stimulating Factor, P-Cell-Stimulating Factor, IL3
This Human IL3 protein spans the amino acid sequence from region 20-152aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molecular Weight: 16.1 kDa
UniProt: P08700
Buffer: Lyophilized from a 0.2 µm filtered 1xPBS, pH 7.4
Source: Homo sapiens (Human)
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Lyophilized powder
Sequence: APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF
Application Notes: Biological Origin: Homo sapiens (Human). Biological Activity: The ED50 as determined in a cell proliferation assay using TF-1 human erythroleukemic cells is 0.3-1.5 ng/ml. Application Notes: Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.




* VAT and and shipping costs not included.
Errors and price changes excepted
Availability
ORDER BY EMAIL
Product Guarantee and Expert Support
BIOZOL