Human IL17F protein

Catalog Number: BYT-ORB594800
Article Name: Human IL17F protein
Biozol Catalog Number: BYT-ORB594800
Supplier Catalog Number: orb594800
Alternative Catalog Number: BYT-ORB594800-10,BYT-ORB594800-50,BYT-ORB594800-500,BYT-ORB594800-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Interleukin-17F, IL-17F, Cytokine ML-1, Interleukin-24, IL-24, IL17F, IL24
This Human IL17F protein spans the amino acid sequence from region 31-163aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molecular Weight: 15.96 kDa
Buffer: Lyophilized from a 0.2 µm filtered 20 mM PB, 150 mM NaCl, pH 7.4
Source: Homo sapiens (Human)
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Lyophilized powder
Sequence: RKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHRVQ
Application Notes: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Mouse IL-17RA-Fc at 1µg/ml can bind Human IL-17F-His, the ED50 of Human IL-17F-His is 47.94 ng/ml. Application Notes: Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.




* VAT and and shipping costs not included.
Errors and price changes excepted
Availability
ORDER BY EMAIL
Product Guarantee and Expert Support
BIOZOL